Sentencedict.com
 Directly to word page Vague search(google)
Home > Curve fitting in a sentence

Curve fitting in a sentence

  up(0)  down(0)
Sentence count:53Posted:2019-11-14Updated:2020-07-24
Similar words: befittingunbefittingpipe fittingloose-fittingclose-fittingfittingfittinglyunfitting
Random good picture Not show
1. Two clear cases show that a curve fit can mislead.
2. Goffman's curves fitted very well to those derived by differential equations validated in epidemiology.
3. Finally adopts the method of curve fitting to do the logarithmic spiral fitting, and then do a comparative analysis with the standard components after fitting the curve.
4. Did curve fitting using least squares method, and then raise the measure veracity.
5. Polynomial curve fitting is a usually used data fitting method. When there are too many data for fitting, only just one polynomial curve function cannot acquire good fitting effect.
6. Prediction of handling capacity of a harbour in Zhejiang Province is carried out by integrating regression (curve fitting)with autoregression analysis.
7. A curve fitting and revising Methods: To hydrometer grain analysis is presented, and proved good satisfactory.
8. The eigenvector extracted by this curve fitting can avoid negative effects of the error endpoints and normalize the length of the pitch contour .
9. Using high-order polynomial curve fitting to smooth pre-processed measurement data can provide good results,(sentencedict.com) but will increase processing complexity and even cause instability.
10. The use of quadrature function curve fitting in excavation volume calculation of earthwork wasdiscussed.
11. A chebyshev's best curve fitting method was introduced in this paper, to improve the exchangeability of photoelectric colorimeter based on numerical value correction.
12. Gives a new curve fitting method for non - linear sens or.
13. The curve fitting method can precisely extract the 4 parameters of sine wave.
14. The log-hyperbolic distribution offers the possibility of a range of curve fittings, one limiting case of which is the log-normal distribution.
15. Software design includes: writing programs of rotate speed computing module, ignition timing computing module and ignition control module and curve fitting.
16. According to a particular analysis of the results by the method of induction and curve fitting, I find that the domain and the length of stuffs will influence the speed and accuracy of segmentation.
17. The OH stretching band of water has been resolved by deconvolution and Gaussian curve fitting.
18. A modal analysis program is developed based on these methods. Stabilization chart is imported to select poles accurately adopting global curve fitting method.
19. This paper presents the odd function with four terms which can be used to make the curve fitting of the stress-strain for various materials precisely.
20. The real time correcting link is set up by using the complex curve fitting method, and the correction is implemented on line.
21. The mathematical expression of the magnetic induction intensity can be obtained by curve fitting method.
22. On the basis of classical edge operator theory and combined with edge tracking and curve fitting theory we developed an algorithm which can deal with the edge of ordinary quality image better.sentencedict.com
23. NLREG is a powerful statistical analysis program that performs linear and nonlinear regression analysis, surface and curve fitting.
24. Moreover, this paper puts forward an adaptive method of control valve based on open-loop and enhances measure accuracy through curve fitting method.
25. The paper, through analyzing the forming of the amplitude spectrum of the echo, proposed a new method using quadratic curve fitting for it.
26. The factors of MOS transistor in the saturation region are analyzed, the mismatch models are optimized, and the model parameter extraction is done by least squares curve fitting method.
27. The proposed method can give more reasonable and more promising prediction results as compared with polynomial curve fitting technique.
28. It is very trouble to make empirical hydrologic frequency curve with curve fitting method by handwork.
29. A false target criterion is introduced to distinguish between potential false objects and true beacon which based on the closed curve fitting of image edge.
30. The multiwave amplitude characteristic processing includes AVO trace gathering, AVo-AVA conversion, AVA curve fitting and attributive section output.
More similar words: befittingunbefittingpipe fittingloose-fittingclose-fittingfittingfittinglyunfittingoutfittingheating curveformfittingill-fittingtight-fittingsurvival of the fittestthe survival of the fittestlearning curvesittinghittingwittingpittingmarketing surveyknittingquittingemittingshittingspittingcurvesplittingunwittingwittingly
Total 53, 30 Per page  1/2  «first  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words